|
|
--- |
|
|
library_name: transformers |
|
|
tags: |
|
|
- gene-ontology |
|
|
- proteomics |
|
|
datasets: |
|
|
- andrewdalpino/AmiGO |
|
|
metrics: |
|
|
- precision |
|
|
- recall |
|
|
- f1 |
|
|
base_model: |
|
|
- facebook/esm2_t30_150M_UR50D |
|
|
pipeline_tag: text-classification |
|
|
--- |
|
|
|
|
|
# ESM2 Protein Function Caller |
|
|
|
|
|
An Evolutionary-scale Model (ESM) for protein function prediction from amino acid sequences using the Gene Ontology (GO). Based on the ESM2 Transformer architecture, pre-trained on [UniRef50](https://www.uniprot.org/help/uniref), and fine-tuned on the [AmiGO](https://huggingface.co/datasets/andrewdalpino/AmiGO) dataset, this model predicts the GO subgraph for a particular protein sequence - giving you insight into the molecular function, biological process, and location of the activity inside the cell. |
|
|
|
|
|
**Note**: This version only models the `cellular component` subgraph of the gene ontology. |
|
|
|
|
|
## What are GO terms? |
|
|
|
|
|
> "The Gene Ontology (GO) is a concept hierarchy that describes the biological function of genes and gene products at different levels of abstraction (Ashburner et al., 2000). It is a good model to describe the multi-faceted nature of protein function." |
|
|
|
|
|
> "GO is a directed acyclic graph. The nodes in this graph are functional descriptors (terms or classes) connected by relational ties between them (is_a, part_of, etc.). For example, terms 'protein binding activity' and 'binding activity' are related by an is_a relationship; however, the edge in the graph is often reversed to point from binding towards protein binding. This graph contains three subgraphs (subontologies): Molecular Function (MF), Biological Process (BP), and Cellular Component (CC), defined by their root nodes. Biologically, each subgraph represent a different aspect of the protein's function: what it does on a molecular level (MF), which biological processes it participates in (BP) and where in the cell it is located (CC)." |
|
|
|
|
|
From [CAFA 5 Protein Function Prediction](https://www.kaggle.com/competitions/cafa-5-protein-function-prediction/data) |
|
|
|
|
|
## Code Repository |
|
|
|
|
|
https://github.com/andrewdalpino/esm2-function-classifier |
|
|
|
|
|
## Model Specs |
|
|
|
|
|
- **Vocabulary Size**: 33 |
|
|
- **Embedding Dimensions**: 640 |
|
|
- **Attention Heads**: 20 |
|
|
- **Encoder Layers**: 30 |
|
|
- **Context Length**: 1026 |
|
|
|
|
|
## Basic Example |
|
|
|
|
|
For a basic demonstration we can rank the GO terms for a particular sequence. For a more advanced example see the [predict-subgraph.py](https://github.com/andrewdalpino/esm2-function-classifier/blob/master/predict-subgraph.py) source file. |
|
|
|
|
|
```python |
|
|
import torch |
|
|
|
|
|
from transformers import EsmTokenizer, EsmForSequenceClassification |
|
|
|
|
|
model_name = "andrewdalpino/ESM2-35M-Protein-Molecular-Function" |
|
|
|
|
|
tokenizer = EsmTokenizer.from_pretrained(model_name) |
|
|
|
|
|
model = EsmForSequenceClassification.from_pretrained(model_name) |
|
|
|
|
|
model.eval() |
|
|
|
|
|
sequence = "MCNAWYISVDFEKNREDKSKCIHTRRNSGPKLLEHVMYEVLRDWYCLEGENVYMM" |
|
|
|
|
|
top_k = 10 |
|
|
|
|
|
out = tokenizer(sequence) |
|
|
|
|
|
input_ids = out["input_ids"] |
|
|
|
|
|
input_ids = torch.tensor(input_ids, dtype=torch.int64).unsqueeze(0) |
|
|
|
|
|
with torch.no_grad(): |
|
|
outputs = model.forward(input_ids) |
|
|
|
|
|
probabilities = torch.sigmoid(outputs.logits.squeeze(0)) |
|
|
|
|
|
probabilities, indices = torch.topk(probabilities, top_k) |
|
|
|
|
|
probabilities = probabilities.tolist() |
|
|
|
|
|
terms = [model.config.id2label[index] for index in indices.tolist()] |
|
|
|
|
|
print(f"Top {args.top_k} GO Terms:") |
|
|
|
|
|
for term, probability in zip(terms, probabilities): |
|
|
print(f"{probability:.4f}: {term}") |
|
|
``` |
|
|
|
|
|
## References: |
|
|
|
|
|
>- A. Rives, et al. Biological structure and function emerge from scaling unsupervised learning to 250 million protein sequences, 2021. |
|
|
>- Z. Lin, et al. Evolutionary-scale prediction of atomic level protein structure with a language model, 2022. |
|
|
>- G. A. Merino, et al. Hierarchical deep learning for predicting GO annotations by integrating protein knowledge, 2022. |
|
|
>- M. Ashburner, et al. Gene Ontology: tool for the unification of biology, 2000. |