README.md

# ESM2 Protein Model

This is the protein component of a jointly trained NT-ESM2 model pair for DNA-protein analysis.

## Model Details

- **Model Type**: ESM2 for protein sequences
- **Training**: Jointly trained with NT DNA model
- **Architecture**: Transformer-based language model for proteins

## Usage

```python
from transformers import AutoModel, AutoTokenizer

# Load model and tokenizer
model = AutoModel.from_pretrained("vsubasri/joint-nt-esm2-transcript-coding-protein")
tokenizer = AutoTokenizer.from_pretrained("vsubasri/joint-nt-esm2-transcript-coding-protein")

# Example usage
protein_sequence = "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG"
inputs = tokenizer(protein_sequence, return_tensors="pt")
outputs = model(**inputs)
```

## Training Details

- Jointly trained with DNA sequences for cross-modal understanding
- Large model variant
- Transcript-specific protein coding sequences

## Files

- `config.json`: Model configuration
- `model.safetensors`: Model weights  
- `tokenizer_config.json`: Tokenizer configuration
- `vocab.txt`: Vocabulary file
- `special_tokens_map.json`: Special tokens mapping

## Citation

If you use this model, please cite the original ESM2 paper and your joint training work.