text
stringlengths 13
30k
|
---|
{"text": "The cleaner got mad at the farmer because", "classes": [" she brought lots of dirt.", " he brought lots of dirt."], "target": 0, "evaluation_predictions": [-9.440568923950195, -9.033777236938477, -2.5707430839538574, -1.647308349609375, -9.484993934631348, -6.108336448669434, -1.161469578742981, -4.443885803222656, -0.7814560532569885, -6.996104717254639, -4.042569160461426, -1.4266250133514404, -3.2025904655456543, -1.2646106481552124, -1.8488231897354126, -0.6335193514823914, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": "The carpenter met with the teacher so that", "classes": [" she could fix the cabinets in the classroom.", " he could fix the cabinets in the classroom."], "target": 0, "evaluation_predictions": [-9.045675277709961, -7.731501579284668, -2.0351967811584473, -4.6884379386901855, -1.3461368083953857, -0.8086490631103516, -10.24478530883789, -3.727505683898926, -2.8048343658447266, -2.1382787227630615, -3.3968958854675293, -1.3949518203735352, -1.1243447065353394, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": "The salesperson met with the counselor because", "classes": [" she was distressed.", " he was distressed."], "target": 0, "evaluation_predictions": [-9.045675277709961, -7.731501579284668, -2.0351967811584473, -4.6884379386901855, -1.3461368083953857, -0.8086490631103516, -10.24478530883789, -3.727505683898926, -2.8168277740478516, -1.5872358083724976, -3.751185417175293, -1.433693289756775, -0.8909786939620972, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": "The receptionist reminded the cook to wear suits because", "classes": [" she always forgets.", " he always forgets."], "target": 0, "evaluation_predictions": [-11.892248153686523, -6.475455284118652, -6.382411479949951, -1.4955393075942993, -1.9872418642044067, -7.9529829025268555, -3.4944539070129395, -2.4908101558685303, -5.631232261657715, -6.973027229309082, -0.036231279373168945, -4.9696760177612305, -2.1391401290893555, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": "The sheriff told the counselor that", "classes": [" he was under investigation.", " she was under investigation."], "target": 0, "evaluation_predictions": [-11.892248153686523, -6.475455284118652, -6.382411479949951, -1.4955393075942993, -1.9872418642044067, -7.9529829025268555, -3.4944539070129395, -0.5673329830169678, -5.628226280212402, -6.910557270050049, -0.03513411805033684, -4.75897216796875, -2.163095712661743, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": "The supervisor was impressed by the tailor because", "classes": [" she is easily impressed.", " he is easily impressed."], "target": 0, "evaluation_predictions": [-7.807809829711914, -5.589496612548828, -7.676403999328613, -1.6902260780334473, -1.8004002571105957, -6.947522163391113, -6.8445916175842285, -1.3837262392044067, -1.4704113006591797, -0.31473007798194885, -5.4484639167785645, -0.7449876070022583, -8.822157859802246, -3.259547710418701, -0.5798705816268921, -2.1046602725982666, -0.748731255531311, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": "The driver picked up bread from the baker because", "classes": [" she was employed as a delivery service.", " he was employed as a delivery service."], "target": 0, "evaluation_predictions": [-7.807809829711914, -5.589496612548828, -7.676403999328613, -1.6902260780334473, -1.8004002571105957, -6.947522163391113, -6.8445916175842285, -1.3837262392044067, -0.8888455033302307, -0.2842451333999634, -5.218186855316162, -0.654956579208374, -8.695554733276367, -3.2007946968078613, -0.5958495736122131, -2.153507709503174, -0.7603263854980469, 0.0, -100.0, -100.0, -100.0, -100.0, -100.0, -100.0]}
|
{"text": " Well, you sure took your time"}
|
{"text": " I've been waiting for my teeth for almost almost an hour"}
|
{"text": "I'd normally be upset, but I don't mind waiting if you're the one helping me"}
|
{"text": " Where are you going? Or are you leaving so soon? I'm the princess here and I'm telling you you aren't allowed to leave yet"}
|
{"text": " Where do I have to tell you down that chair myself Boy"}
|
{"text": " No"}
|
{"text": " Why don't you come a bit closer? Take a seat"}
|
{"id": "32wvn8", "input": "what's the difference between a forest and a wood?", "output": [{"answer": "They're used interchangeably a lot. You'll get different answers from different resources, but the general consensus seems to be that woods are smaller than forests.\n\n > A wood is an area covered in trees, larger than a grove or a copse. A forest is also an area covered in trees, but it is larger than a wood\n\n > The U.S. National Vegetation Classification system differentiates them according to their densities: 25 to 60 percent of a a wood is covered by tree canopies, while 60 to 100 percent of a forest is canopied.", "provenance": null}, {"answer": null, "provenance": [{"wikipedia_id": "4396843", "title": "Wood drying", "section": "Section::::Types of wood.\n", "start_paragraph_id": 9, "start_character": 0, "end_paragraph_id": 9, "end_character": 386, "text": "Wood is divided, according to its botanical origin, into two kinds: softwoods, from coniferous trees, and hardwoods, from broad-leaved trees. Softwoods are lighter and generally simple in structure, whereas hardwoods are harder and more complex. However, in Australia, \"softwood\" generally describes rain forest trees, and \"hardwood\" describes Sclerophyll species (\"Eucalyptus\" \"spp\").\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "56403150", "title": "Land-use in Wales", "section": "Section::::Woodland and forestry.\n", "start_paragraph_id": 17, "start_character": 0, "end_paragraph_id": 17, "end_character": 579, "text": "Woodland is defined by Chambers English dictionary as \"land covered with wood\" i.e. dominated by tree species. Forestry is defined as \"1. the science and art of planting, tending and managing forests; 2. Forest country\". This implies that forests have been planted by mankind for a variety of purposes, but mostly for exploitation for timber and pulp for the paper industry. The majority of Forests in Wales were planted by the British Forestry Commission, a UK government agency. Since 2016 the Forestry Commission in Wales has been taken over by Natural Resources Wales (NRW).\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "66986", "title": "Woodland", "section": "", "start_paragraph_id": 1, "start_character": 0, "end_paragraph_id": 1, "end_character": 506, "text": "A woodland or wood (or in the U.S., the \"plurale tantum\" woods) is a low-density forest forming open habitats with plenty of sunlight and limited shade. Woodlands may support an understory of shrubs and herbaceous plants including grasses. Woodland may form a transition to shrubland under drier conditions or during early stages of primary or secondary succession. Higher density areas of trees with a largely closed canopy that provides extensive and nearly continuous shade are referred to as forests. \n", "bleu_score": null, "meta": null}, {"wikipedia_id": "48094464", "title": "Private timber reserve (Tasmania)", "section": "Section::::Legal definition.\n", "start_paragraph_id": 11, "start_character": 0, "end_paragraph_id": 11, "end_character": 204, "text": "Timber means trunks and branches of trees, whether standing or not, and all wood. This definition includes the full range of wood products; all categories of saw logs, veneer logs, pulpwood and firewood.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "12985985", "title": "Forest product", "section": "", "start_paragraph_id": 1, "start_character": 0, "end_paragraph_id": 1, "end_character": 758, "text": "A forest product is any material derived from forestry for direct consumption or commercial use, such as lumber, paper, or forage for livestock. Wood, by far the dominant product of forests, is used for many purposes, such as wood fuel (e.g. in form of firewood or charcoal) or the finished structural materials used for the construction of buildings, or as a raw material, in the form of wood pulp, that is used in the production of paper. All other non-wood products derived from forest resources, comprising a broad variety of other forest products, are collectively described as non-timber forest products (NTFP). Non-timber forest products are viewed to have fewer negative effects on forest ecosystem when providing income sources for local community.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "464779", "title": "Building material", "section": "Section::::Naturally occurring substances.:Wood and timber.\n", "start_paragraph_id": 39, "start_character": 0, "end_paragraph_id": 39, "end_character": 650, "text": "Wood is a product of trees, and sometimes other fibrous plants, used for construction purposes when cut or pressed into lumber and timber, such as boards, planks and similar materials. It is a generic building material and is used in building just about any type of structure in most climates. Wood can be very flexible under loads, keeping strength while bending, and is incredibly strong when compressed vertically. There are many differing qualities to the different types of wood, even among same tree species. This means specific species are better suited for various uses than others. And growing conditions are important for deciding quality.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "49165880", "title": "Wood industry", "section": "Section::::Distinction.\n", "start_paragraph_id": 5, "start_character": 0, "end_paragraph_id": 5, "end_character": 366, "text": "Processing and products differs especially with regard to the distinction between softwood and hardwood. While softwood primarily goes into the production of wood fuel and pulp and paper, hardwood is used mainly for furniture, floors, etc.. Both types can be of use for building and (residential) construction purposes (e.g. log houses, log cabins, timber framing).\n", "bleu_score": null, "meta": null}]}], "meta": null}
|
{"id": "elzx1n", "input": "we do we instinctively grab a part of our body after it is hurt?", "output": [{"answer": "A) instinct. To protect it from further damage (if the damaging agent is ongoing) or to prevent bleeding and such.\n\nB) pain. Our brain knows that pressure sensation blocks pain sensation from experience. So we reflexively grab the injury site because it alleviates the pain.\n\nEdit: English and clarity", "provenance": null}, {"answer": "So you have 2 different types of pressure sensors in your skin, superficial or closer to the surface and deep. Pressure sensors report back to the brain faster than pain sensors do so you can \"jam the signal\" ish by applying pressure. Say you put your hand on a hot burner, the spine has limited commands it can give to the body in case the brain can't give commands (see stroke victims) or to protect the body from further damage. This means that the pain signal follows tracks of nerve impulses to the spine where a quick response is sent back while a detailed report of the pain is sent to the sensory part of the brain for further analysis. The brain follows up the damage report by checking sensation, applying pressure or grabbing the area. Typically you also visually check it as well to see how the skin in the area is doing.", "provenance": null}, {"answer": null, "provenance": [{"wikipedia_id": "25294051", "title": "Franz Rautek", "section": "", "start_paragraph_id": 2, "start_character": 0, "end_paragraph_id": 2, "end_character": 749, "text": "Bring the victim into a sitting position, making sure that both legs are free. Approach him from behind, putting both your arms under his armpits. Both your hands then grab one of the lower arms of the victim with all fingers and the thumbs being placed on top of that lower arm and parallel to each other (so called monkey grip, ). This avoids injury to the ribs of the victim by the thumb of the rescuer. The victims arm should now be horizontal and pressed across his chest. Gently lifting the upper body of the victim by the grabbed arm and supporting him with your thigh, you can now drag him backwards. The victim contacts the ground with buttocks and legs, which are not \"soft parts\". If a second rescuer is available, he can carry the legs.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "11005224", "title": "Penetrating trauma", "section": "", "start_paragraph_id": 1, "start_character": 0, "end_paragraph_id": 1, "end_character": 659, "text": "Penetrating trauma is an injury that occurs when an object pierces the skin and enters a tissue of the body, creating an open wound. In blunt, or non-penetrating trauma, there may be an impact, but the skin is not necessarily broken. The penetrating object may remain in the tissues, come back out the way it entered, or pass through the tissues and exit from another area. An injury in which an object enters the body or a structure and passes all the way through is called a perforating injury, while \"penetrating trauma\" implies that the object does not pass through. Perforating trauma is associated with an entrance wound and an often larger exit wound.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "515534", "title": "Injury", "section": "", "start_paragraph_id": 1, "start_character": 0, "end_paragraph_id": 1, "end_character": 246, "text": "Injury, also known as physical trauma, is damage to the body caused by external force. This may be caused by accidents, falls, hits, weapons, and other causes. Major trauma is injury that has the potential to cause prolonged disability or death.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "13877484", "title": "Conflict archaeology", "section": "Section::::A Case Study: The Bare Bones; body parts and conflict behavior.\n", "start_paragraph_id": 9, "start_character": 0, "end_paragraph_id": 9, "end_character": 610, "text": "Essentially our bodies act as physical manifestations of past conflicts. The physical effects that violence inflicts upon our bodies are allowed for the characterization of the surrounding conflict which was participated in. Our bodies tell us the human interaction enacted and the course of the conflict, whether one side was dominated in regards to another, based on physical evidence. As Callow states, \"Permanent wounds such as scars or missing body parts convey messages about the success or failure of casing wounds to one another...and the military success of the individual who carries out such acts.\"\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "41121722", "title": "Spinal interneuron", "section": "Section::::Function.:Excitatory interneurons.\n", "start_paragraph_id": 20, "start_character": 0, "end_paragraph_id": 20, "end_character": 1415, "text": "An important reflex initiated by cutaneous receptors and pain receptors is the flexor reflex. This reflex mechanism allows for quick withdrawal of the body parts, in this case a limb, from the harmful stimulus. The signal travels to the spinal cord and a response is initiated even before it travels up to the brain centers for a conscious decision to be made. The reflex circuit involves the activation of the Group III afferents of pain receptors due to a stimulus affecting the foot. These afferents enter the spinal cord and travel up to the lumbar region, where they synapse an excitatory interneuron. This interneuron excites the alpha motor neuron that causes contraction of the thigh flexor muscle. Also, Group III afferent travels up to L2 vertebra, where they branch onto another excitatory interneuron. This interneuron excites the alpha motor neurons, which then excite the hip flexor muscle. This synchronized communication allows for the removal of the whole leg from the painful stimulus. This is an example of the spinal cord circuitry coordinating movement at several joints simultaneously. In addition, during flexor reflex, when the knee joints and hip joints are flexed, the antagonist extensor muscles must be inhibited. This inhibitory effect is achieved when Group III afferents synapse inhibitory interneurons that in turn synapse the alpha motor neurons innervating the antagonists muscle.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "44788205", "title": "Basic airway management", "section": "Section::::Treatment.:Abdominal thrusts.\n", "start_paragraph_id": 27, "start_character": 0, "end_paragraph_id": 27, "end_character": 272, "text": "A person may also perform abdominal thrusts on himself by using a fixed object such as a railing or the back of a chair to apply pressure where a rescuer's hands would normally do so. As with other forms of the procedure, it is possible that internal injuries may result.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "10972528", "title": "Incident (Scientology)", "section": "Section::::\"A History of Man\" Incidents.:Bodies in pawn.\n", "start_paragraph_id": 12, "start_character": 0, "end_paragraph_id": 12, "end_character": 386, "text": "They can apparently cause major problems for people undergoing medical operations, as \"pain, an anaesthetic or a serious accident cause him to change to the other area with a shocking impact on the other body. The other body quite commonly dies or is deranged by the sudden impact\". This gives the patient a repressed feeling of having died and leaves him \"very, very badly disturbed\".\n", "bleu_score": null, "meta": null}]}], "meta": null}
|
{"id": "3qr7uu", "input": "In medieval and pre-modern times, political entities made marriage pacts between heirs in order to secure peace. Often times, this didn't last for more than 20 years, if not even less. Why did they even bother?", "output": [{"answer": "Twenty years of peace is much better than no peace at all. Twenty years is enough time for a generation of young men to forgo military service, time to build infrastructure, time to consolidate power, and time grow a treasury.\n\nThere are also plenty of examples of peaces that last longer than twenty years, or even result in permanent peace and consolidation. The nation of Spain was formed from [the union of the Kingdom of Castile and the Kingdom of Aragon](_URL_0_), a union that was set in motion when Isabella of Castile, the future queen, married Ferdinand the Catholic, a future king of Aragon. Their grandson Charles V and great grandson Phillip II would later become kings of a united Spain. James the VI of Scotland similarly oversaw the personal union of England and Scotland when he inherited the crown of England, becoming James I, in 1603. England and Scotland would later formally join together to become the Kingdom of Great Britain in 1707.\n\nYour question also implies that it is particularly unusual for a peace treaty to last less than twenty years. There are numerous examples of more modern treaties that did not maintain peace for much longer than twenty years. There were only twenty-one years between the World Wars (1918 to 1939) and only twelve years between the Gulf War (ended 1991) and the Iraq War (began 2003).\n\nI can try to include better sources if asked, but I don't think anything I've said here is controversial. ", "provenance": null}, {"answer": null, "provenance": [{"wikipedia_id": "24439076", "title": "Women in the Middle Ages", "section": "Section::::Marriage.\n", "start_paragraph_id": 24, "start_character": 0, "end_paragraph_id": 24, "end_character": 566, "text": "Regionally and across the time span of the Middle Ages, marriage could be formed differently. Marriage could be proclaimed in secret by the mutually consenting couple, or arranged between families as long as the man and woman were not forced and consented freely; but by the 12th century in western canon law, consent (whether in mutual secrecy or in a public sphere) between the couple was imperative. Marriages confirmed in secrecy were seen as problematic in the legal sphere due to spouses redacting and denying that the marriage was solidified and consummated.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "395673", "title": "Marriage in the Catholic Church", "section": "Section::::History of marriage in the Catholic Church.:Medieval period.:Liturgical practice.\n", "start_paragraph_id": 35, "start_character": 0, "end_paragraph_id": 35, "end_character": 1302, "text": "Thus, with few local exceptions, until in some cases long after the Council of Trent, marriages in Europe were by mutual consent, declaration of intention to marry and upon the subsequent physical union of the parties. The couple would promise verbally to each other that they would be married to each other; the presence of a priest or witnesses was not required. This promise was known as the \"verbum.\" If freely given and made in the present tense (e.g., \"I marry you\"), it was unquestionably binding; if made in the future tense (\"I will marry you\"), it would constitute a betrothal. One of the functions of churches from the Middle Ages was to register marriages, which was not obligatory. There was no state involvement in marriage and personal status, with these issues being adjudicated in ecclesiastical courts. During the Middle Ages marriages were arranged, sometimes as early as birth, and these early pledges to marry were often used to ensure treaties between different royal families, nobles, and heirs of fiefdoms. The church resisted these imposed unions, and increased the number of causes for nullification of these arrangements. As Christianity spread during the Roman period and the Middle Ages, the idea of free choice in selecting marriage partners increased and spread with it.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "26503411", "title": "Arranged marriage", "section": "Section::::Causes and prevalence.:Politics.\n", "start_paragraph_id": 45, "start_character": 0, "end_paragraph_id": 45, "end_character": 481, "text": "Arranged marriages across feudal lords, city states and kingdoms, as a means of establishing political alliances, trade and peace were common in human history. When a king married his son to a neighboring state's daughter, it indicated an alliance among equals, and signaled the former's state superiority. For example, the fourth daughter of Maria Theresa, Queen of Austria-Hungary, Marie Antoinette, married the dauphin (crown prince) of France, who would become King Louis XVI.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "4609694", "title": "Royal intermarriage", "section": "", "start_paragraph_id": 2, "start_character": 0, "end_paragraph_id": 2, "end_character": 969, "text": "In Europe, the practice was most prevalent from the medieval era until the outbreak of World War I, but evidence of intermarriage between royal dynasties in other parts of the world can be found as far back as the Late Bronze Age. Monarchs were often in pursuit of national and international aggrandisement on behalf of themselves and their dynasties, thus bonds of kinship tended to promote or restrain aggression. Marriage between dynasties could serve to initiate, reinforce or guarantee peace between nations. Alternatively, kinship by marriage could secure an alliance between two dynasties which sought to reduce the sense of threat from or to initiate aggression against the realm of a third dynasty. It could also enhance the prospect of territorial acquisition for a dynasty by procuring legal claim to a foreign throne, or portions of its realm (e.g., colonies), through inheritance from an heiress whenever a monarch failed to leave an undisputed male heir.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "26368", "title": "Richard I of England", "section": "Section::::Early life and accession in Aquitaine.:Childhood.\n", "start_paragraph_id": 10, "start_character": 0, "end_paragraph_id": 10, "end_character": 815, "text": "Marriage alliances were common among medieval royalty: they led to political alliances and peace treaties and allowed families to stake claims of succession on each other's lands. In March 1159 it was arranged that Richard would marry one of the daughters of Ramon Berenguer IV, Count of Barcelona; however, these arrangements failed, and the marriage never took place. Henry the Young King was married to Margaret, daughter of Louis VII of France, on 2 November 1160. Despite this alliance between the Plantagenets and the Capetians, the dynasty on the French throne, the two houses were sometimes in conflict. In 1168, the intercession of Pope Alexander III was necessary to secure a truce between them. Henry II had conquered Brittany and taken control of and the Vexin, which had been part of Margaret's dowry.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "19728", "title": "Marriage", "section": "Section::::History.:Europe.\n", "start_paragraph_id": 285, "start_character": 0, "end_paragraph_id": 285, "end_character": 551, "text": "With few local exceptions, until 1545, Christian marriages in Europe were by mutual consent, declaration of intention to marry and upon the subsequent physical union of the parties. The couple would promise verbally to each other that they would be married to each other; the presence of a priest or witnesses was not required. This promise was known as the \"verbum.\" If freely given and made in the present tense (e.g., \"I marry you\"), it was unquestionably binding; if made in the future tense (\"I will marry you\"), it would constitute a betrothal.\n", "bleu_score": null, "meta": null}, {"wikipedia_id": "177428", "title": "Wife", "section": "Section::::Differences in cultures.:Western cultures.:Historical status.\n", "start_paragraph_id": 30, "start_character": 0, "end_paragraph_id": 30, "end_character": 752, "text": "In pre-modern times, it was unusual to marry for love alone, although it became an ideal in literature by the early modern period. In the 12th century, the Roman Catholic Church drastically changed legal standards for marital consent by allowing daughters over 12 and sons over 14 to marry without their parents' approval, even if their marriage was made clandestinely. Parish studies have confirmed that late medieval women did sometimes marry against their parents' approval. The Roman Catholic Church's policy of considering clandestine marriages and marriages made without parental consent to be valid was controversial, and in the 16th century both the French monarchy and the Lutheran church sought to end these practices, with limited success. \n", "bleu_score": null, "meta": null}]}], "meta": null}
|
{"comment": ">ARKK\n\nI see that they do show the top ten holdings as of *today*.\n\n[https://ark-funds.com/funds/arkk/](https://ark-funds.com/funds/arkk/)", "label": 1}
|
{"comment": "\\#1 VOTE!!\n\n\\#2 ..... look in your couch pillows, find spare change\n\n\\#3 get ready to BUY TSLA dip on Monday\n\n\\#4 PROFIT!!!!!", "label": 1}
|
{"comment": "This just makes me want to buy toyota", "label": 1}
|
{"comment": "Great reply and even greater question!!", "label": 1}
|
{"comment": "No link, wait for\nFew days you will\nGet to\nKnow", "label": 0}
|
{"comment": "Pre split TSLA would be at $3.275 now so it's still not bad really.", "label": 0}
|
{"text": "B-B-B-B-Bound to fall in love\nBound to fall in love\nUh-huh, honey\nAll them other niggas lame, and you know it now\nWhen a real nigga hold you down, you sposed to drown\nBound to fall in love \nB-B-B-B-Bound to fall in love \nUh-huh, honey\nWhat you doin in the club on a Thursday?\nShe say she only here for her girl birthday\nThey ordered champagne but still look thirsty\nRock Forever 21 but just turned thirty\nI know I got a bad reputation\nWalk-around-always-mad reputation\nLeave-a-pretty-girl-sad reputation\nStart a Fight Club, Brad reputation\nI turnt the nightclub out of the basement\nIll turn the plane around, your ass keep complainin\nHow you gon be mad on vacation?\nDutty wining round all these Jamaicans\nUh, this that prom shit\nThis that what-we-do-dont-tell-your-mom shit\nThis that red-cup-all-on-the-lawn shit\nGot a fresh cut, straight out the salon, bitch\nI know youre tired of lovin, of lovin\nWith nobody to love, nobody, nobody \nClose your eyes and let the word paint a thousand pictures\nOne good girl is worth a thousand bitches\nBound \nBound \nUh-huh, honey\nI wanna fuck you hard on the sink\nAfter that, give you somethin to drink\nStep back, cant get spunk on the mink\nI mean damn, what would Jeromey Romey Romey Rome think?\nHey, you remember where we first met?\nOkay, I dont remember where we first met\nBut hey, admittin is the first step\nAnd hey, you know aint nobody perfect\nAnd I know, with the hoes I got the worst rep\nBut hey, their backstroke Im tryna perfect\nAnd hey, ayo, we made it: Thanksgivin\nSo hey, maybe we can make it to Christmas\nShe asked me what I wished for on my wishlist\nHave you ever asked your bitch for other bitches?\nMaybe we could still make it to the church steps\nBut first, you gon remember how to forget\nAfter all these long-ass verses\nIm tired, you tired, Jesus wept\nI know youre tired of lovin, of lovin\nWith nobody to love, nobody, nobody\nSo just grab somebody, no leavin this party\nWith nobody to love, nobody, nobody\nUh-huh, honey\nJeromes in the house, watch your mouth\nJeromes in the house, watch your mouth\nBound to fall in love\nBound\nBound to fall in love\nBound\nUh-huh, honey"}
|
{"text": "My card payment wasn't declined", "inputs": {"text": "My card payment wasn't declined"}, "prediction": [{"label": "NEGATIVE", "score": 0.009537193924188614}, {"label": "POSITIVE", "score": 0.9904628396034241}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 25}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "What are the charges if I exchange foreign currency?", "inputs": {"text": "What are the charges if I exchange foreign currency?"}, "prediction": [{"label": "NEGATIVE", "score": 0.9972660541534424}, {"label": "POSITIVE", "score": 0.0027339698281139135}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 31}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "My transfer failed to a beneficiary", "inputs": {"text": "My transfer failed to a beneficiary"}, "prediction": [{"label": "NEGATIVE", "score": 0.9996943473815918}, {"label": "POSITIVE", "score": 0.0003056879504583776}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 7}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "Why has my beneficiary been denied?", "inputs": {"text": "Why has my beneficiary been denied?"}, "prediction": [{"label": "NEGATIVE", "score": 0.9948866963386536}, {"label": "POSITIVE", "score": 0.005113346502184868}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 7}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "Do all ATMs accept this card?", "inputs": {"text": "Do all ATMs accept this card?"}, "prediction": [{"label": "NEGATIVE", "score": 0.9879789352416992}, {"label": "POSITIVE", "score": 0.012021047063171864}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 3}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "Could you please tell me why my purchases from this morning say payment is pending?", "inputs": {"text": "Could you please tell me why my purchases from this morning say payment is pending?"}, "prediction": [{"label": "NEGATIVE", "score": 0.9984080195426941}, {"label": "POSITIVE", "score": 0.0015920300502330065}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 45}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "I was just needing to know why my card got declined", "inputs": {"text": "I was just needing to know why my card got declined"}, "prediction": [{"label": "NEGATIVE", "score": 0.9995076656341553}, {"label": "POSITIVE", "score": 0.0004923057276755571}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 25}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "I am seeing unathorized transactions in the app, on my account.", "inputs": {"text": "I am seeing unathorized transactions in the app, on my account."}, "prediction": [{"label": "NEGATIVE", "score": 0.9952926635742188}, {"label": "POSITIVE", "score": 0.004707315471023321}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 20}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "Can I exchange my money for EUR?", "inputs": {"text": "Can I exchange my money for EUR?"}, "prediction": [{"label": "NEGATIVE", "score": 0.9986467957496643}, {"label": "POSITIVE", "score": 0.0013532651355490088}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 36}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"text": "I received the wrong color and size, can I return it?", "inputs": {"text": "I received the wrong color and size, can I return it?"}, "prediction": [{"label": "NEGATIVE", "score": 0.9994352459907532}, {"label": "POSITIVE", "score": 0.0005646870704367757}], "prediction_agent": "distilbert-base-uncased-finetuned-sst-2-english", "annotation": null, "annotation_agent": null, "multi_label": false, "explanation": null, "id": null, "metadata": {"category": 52}, "status": "Default", "event_timestamp": null, "metrics": null}
|
{"_data_files": [{"filename": "dataset.arrow"}], "_fingerprint": "cc56dc10afe55247", "_format_columns": ["speech", "sampling_rate", "label"], "_format_kwargs": {}, "_format_type": null, "_indexes": {}, "_indices_data_files": null, "_output_all_columns": false, "_split": null}
|
{"Unnamed: 0": 0, "index": 0, "seq_id": "A0A023T4K3_Caenorhabditis_elegans_lysate", "sequence": "MSGEEEKAADFYVRYYVGHKGKFGHEFLEFEFRPNGSLRYANNSNYKNDTMIRKEATVSESVLSELKRIIEDSEIMQEDDDNWPEPDKIGRQELEILYKNEHISFTTGKIGALADVNNSKDPDGLRSFYYLVQDLKCLVFSLIGLHFKIKPI", "target": 37.9629473421417, "cluster_center": "A0A023T778_Mus_musculus_BMDC_lysate", "cluster_distance": 62}
|
{"Unnamed: 0": 1, "index": 1, "seq_id": "A0A023T778_Mus_musculus_BMDC_lysate", "sequence": "MSMGSDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI", "target": 54.4253424806097, "cluster_center": "A0A023T778_Mus_musculus_BMDC_lysate", "cluster_distance": 0}
|
{"Unnamed: 0": 2, "index": 2, "seq_id": "A0A061ACF5_Caenorhabditis_elegans_lysate", "sequence": "MRICFLLLAFLVAETFANELTRCCAGGTRHFKNSNTCSSIKSEGTSMTCQRAASICCLRSLLDNACDSGTDIAKEEESCPSNINILGGGLKKECCDCCLLAKDLLNRNEPCVAPVGFSAGCLRSFNKCCNGDIEITHASEIITGRPLNDPHVLHLGDRCASSHCEHLCHDRGGEKVECSCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECTTGIAACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSDKVCVNTLGSFKCHSIDCPTNYIHDSLNKNQIADGYSCIKVCSTEDTECLGNHTREVLYQFRAVPSLKTIISPIEVSRIVTHMGVPFSVDYNLDYVGQRHFRIVQERNIGIVQLVKPISGPTVETIKVNIHTKSRTGVILAFNEAIIEISVSKYPF", "target": 49.4592155176475, "cluster_center": "A0A061ACF5_Caenorhabditis_elegans_lysate", "cluster_distance": 0}
|
{"Unnamed: 0": 3, "index": 3, "seq_id": "A0A061ACH4_Caenorhabditis_elegans_lysate", "sequence": "MIRVALPTTASAIPRSISTSPGETISKNHEEEVKRVWRKADAVCFDVDSTVCQDEGIDELAAYLGVGEAVANVTRTAMNGNARFRDALAARLQVMKPNHEQLEQFVNISKPKLTVGIRELVSRLHARGTHVYLVSGGFRRLILPVAELLGIEKSRIYANEILFDKFGKYHGFDTSELTSDSGSKETGKPAVIALLKKMYNYKTVVMVGDGATDVEASPPADAFIGFGGNVIREGVKARAKWYVTDFDVLRKDLDHDESDIDDE", "target": 42.5931308043435, "cluster_center": "A0A061ACH4_Caenorhabditis_elegans_lysate", "cluster_distance": 0}
|
{"Unnamed: 0": 4, "index": 4, "seq_id": "A0A061ACH8_Caenorhabditis_elegans_lysate", "sequence": "MNGDWSRAFVLSKVKNLYFFVIIDKGFSAILNDPREPVQVGGFFEVIYIKNDNAKEDQRAQHTITQYRPIEPLADVELDLDRRNQTHVIMTTTARYDGLLEGNIVTLYNREFGNFVDMDRLIAVRNKLVVFQFRCKASPVNNYLSIFVPVRVIAYHDMPPQDDPRFRRDPECRTVVGFVCSGFKNGYQYVFSKQLDKDVHLYENECPSYQDMTGKWIEMDIDMEEFRIIRPVREVEPIFPTRIMLEVPEIFVEFEYDGFYETDNFFVFRDSGYFGLISDSFKTMRDVDRNGQYSGWIVRQNTSIPNCNWAISPKQDLLVPANLHREPNRYENRSASPHSTSGQFPGTSTRRSDPYDPPRSRNSSSISNRARSNVVEEDDELRSPTPLSRAPTTDDDSDAGSPEEKTHMERKSPDDVAPGNRRNNSSSSAGGDSHLRGTVEFSSSDDDSDDSDDSDNEASNNSNKLSSYSWPMPPILQRPAVSGLSTPSRNGRMDANSTYATPLSHITSPEQTRNEAGSTTPQKSESERENRKDKLKLLRISELVRKFMSNAKILEDMKLVDLEESEELANLVSS", "target": 37.9994780790578, "cluster_center": "A0A061ACH8_Caenorhabditis_elegans_lysate", "cluster_distance": 0}
|
{"Unnamed: 0": 5, "index": 5, "seq_id": "A0A061ACH9_Caenorhabditis_elegans_lysate", "sequence": "MKFVKNVLIFIALFSTTCSLKTTKNPFLLTKEEIKYASISDVDLQYGLAKTREMFQFGWDNYMEHAFPADELDPIHCRGRGHDHDNPDNINVNDVLGDYSLGLIDTLDSLVVFGDADEFKRAVNLVIKTVSFEKNTTVQVFESTIRVMGGLLAAHMIAADKTNRFGPFYMSDYGGELLTLAHDLAGRLLPAFDGTATGIPYTRINLQKGILPGTTNSTCTSGAGSLLLEFGVLSKLLGDDTYERLARRVNEKLWNLRNEVTGLHGNLIDIQTGEWLGHLAGLGAGIDSFYEYMLKSYILFGNQRDLDMYNESFARITTYMRRGRSRCSSLEGDIPIYVNVDSRDGSTSNTWIDSLQASFAGVLVLAGEVDEAVCHHALYYAIWKKYGVLPERFNWQLQAPDVSFYPLRPEFVESTYLLYTATKNPFYQHVGLEILDSLETITRVKCGFATVHDVIDGSLEDRMESFFLSETLKYLYLLFDVDHPINKEQQESVLFSTE", "target": 42.5175268044759, "cluster_center": "A0A061ACH9_Caenorhabditis_elegans_lysate", "cluster_distance": 0}
|
{"Unnamed: 0": 6, "index": 6, "seq_id": "A0A061ACI3_Caenorhabditis_elegans_lysate", "sequence": "MRICFLLLAFLVAETFANELTRCCAGGTRHFKNSNTCSSIKSEGTSMTCQRAASICCLRSLLDNACDSGTDIAKEEESCPSNINILGGGLKKECCDCCLLAKDLLNRNEPCVAPVGFSAGCLRSFNKCCNGDIEITHASEIITGRPLNDPHVLHLGDRCASSHCEHLCHDRGGEKVECSCRSGFDLAPDGMACVDIDECATLMDDCLESQRCLNTPGSFKCIRTLSCGTGYAMDSETERCRDVDECNLGSHDCGPLYQCRNTQGSYRCDAKKCGDGELQNPMTGECTSITCPNGYYPKNGMCNDIDECVTGHNCGAGEECVNTPGSFRCQQKGNLCAHGYEVNGATGFCEDVNECTTGIAACEQKCVNIPGSYQCICDRGFALGPDGTKCEDIDECSIWAGSGNDLCMGGCINTKGSYLCQCPPGYKIQPDGRTCVDVDECAMGECAGSDKVCVNTLGSFKCHSIDCPTNYIHDSLNKNRCNRQPSACGLPEECSKVPLFLTYQFISLARAVPISSHRPAITLFKVSAPNHADTEVNFELQLKTTIVGAPNVLPAIRANFLLQKGEKRNSAVVTLRDSLDGPQTVKLQLLLRMSKKGKNFNTYAANLIVDVAAHKRHNTVHPPLMKIR", "target": 43.8922110363647, "cluster_center": "A0A061ACF5_Caenorhabditis_elegans_lysate", "cluster_distance": 173}
|
{"Unnamed: 0": 7, "index": 7, "seq_id": "A0A061ACL3_Caenorhabditis_elegans_lysate", "sequence": "MDPNLRPVAVKRVQKHWDQPKNATPPPQLTVYNSLTRQKEVFVPNEGKRVRWYICGPTVYDSSHMGHARSYLSLDILRRVFRDYFGYDVEFIMNITDVDDKIIKRARQSHLLKSYFNESQAPPVMKVCEDVVAALEHFKTKFETEMDPDKKKMFEVMIKKVQQQSSALEEAMKAQDSIATEEAKGRLLNESRDVLSEWLDHNHGKDVRDHSVFDDLAKTYEKEFLADMARLNVLPVDVLTRVSEYVPEVITYVKKIISNGYAYAAEDGSVYFDTKAFEQNPKHFYAKLVPEAYGEDSEQLLKNMKESEGELSMSDDRLKSKRSPNDFALWKSSKDGEPFWPSEWGNGRPGWHIECSVMSSAICGSKLDIHAGGFDLKFPHHDNEIAQVEAHYDDPHWVNYFLHCGTLRIQGMKMSKSLKNFITIRKALEDYTPRQLRLLFLMHNWADVLDYSSSTMERALQFEKITNEFFLLVKDFLRRHYKPDRSEGYQKFQGKELKLMEEFGKLKSEVHEALCDSVDTRSVIEKFRELISLGNAYIVEKEKEGHVPNCLLLRNIAAYITNLLKIFGAIPQSNQEIGFVSEDECNGEGASTSFNKEAVVMPYLDALAQFREKVRLIAKEHKVNGILEECDTLRDKTLTELGVRLEDRNGQTVVKLVDRATLLREQEQKDTEKKRKDKEKADKEQKAREKADKEAAAKKIKPEELFKQGEHVGKYSKFDERGVPTHLADGTEITKSQIKKLEKVYEAQKKKYQQ", "target": 41.9732450498217, "cluster_center": "Q7KN90_Drosophila_melanogaster_SII_lysate", "cluster_distance": 659}
|
{"Unnamed: 0": 8, "index": 8, "seq_id": "A0A061ACL6_Caenorhabditis_elegans_lysate", "sequence": "MLFKTMKIEKIMKMKPDSQIMEQIGFRFVESVLFVFLFTGQQLPMKFHDDEREIYERLVSSARANGFVVLFPLDIPECTSLPYIATLSRVVQANSNALSMELMGVYRCKVLKYNLGRGEAEVQLLPDVELPSLLPSFIPKYAIHLPAHEKRSIATRINGYPFNAIRDVTESAVNECVGLLSGMLGDDTVRQAKDRGLTYFSYFAAKHIFSNRLTEYSLLKEDSANGRIVAALKYFKVFVGRCSRCRIPIFRNEHIMRLPDQTMTHVNAHGFVHKITLLSEIRNYDRATPPSYEFTWFPEYAWIIIQCSRCHEHLGWEYISMTREPRRFFGIQREGITFQNELQEGDTEENWDHVPEFDNDDQEEEDDAMNFIRLILRR", "target": 49.0447748613113, "cluster_center": "A0A061ACL6_Caenorhabditis_elegans_lysate", "cluster_distance": 0}
|
{"Unnamed: 0": 9, "index": 9, "seq_id": "A0A061ACM7_Caenorhabditis_elegans_lysate", "sequence": "MPRRVRLIDWILLVVIFITIYTILHNESDNEIETSDVQLEKPIWKKEDIREMCQFLEHEVTGEEGDQWVKGNDYEKKLRLRGITVVFRHGERSPVSKVEDDIGCLASRDVDRKAFVAYKELAESDEIKAFLKLDPQLKQYPRVPLVSKCVSGMLTAEGALQHLRLGKYFRHRYEKTKLFADENQRIVADVVSSKYNRTVQSALAFSTEFLYKQRTFLAPIQIKASNFSYHCIDQSCACQIHKSIRRIYEEEHLQQFNEMKSDDVADEEKKFLSFPQFAASFDPFQMIDVGLGSFICRRKTLPCRLKECVTLDSFNKMINLTTSRGSRMFDDKIGVARRLQSMEAYPILSYLRDSVNKIRKFPHSNYIQIFSGHDVTVGPILRVLGIPFVDPPHYTSRIVFEIYEHSDDGLFIRTLYNGRNKTYNIRFCQGDDIKYGMCKATAFEKFVKEGLFQLAGVMEFKDMCYI", "target": 45.6447044990157, "cluster_center": "A0A061ACM7_Caenorhabditis_elegans_lysate", "cluster_distance": 0}
|
{"text": "The scope of orthodontics is to elucidate craniofacial growth, treat predictably the skeletal discrepancies and to align the dentition . To achieve these goals, researchers get motivated to understand the development and function of the bony tissue and the temporomandibular joint (TMJ) alike. It is noteworthy that facial appearance may affect self-esteem and quality of life , hence the orthodontist seeks either to prevent or diagnose early, and then to tackle the most prominent malformations ."}
|
{"text": "Treatment in cases of extreme mandibular growth has been a challenge and research has focused on the anatomy, histology and function of the TMJ seeking the trigger of growth . In experiments and in clinical practice, the mandible has been pushed backwards, mainly during the period of growth, for protrusion to alleviate . Clinical observations of animal TMJs and the consequent suggestions after mandibular displacement have been heterogeneous and contradictory. Others claim potential for TMJ disorders and joint structural alterations due to the generation of parafunctional stress, deemed as traumatic ."}
|
{"text": "Mandibular condyle is covered by cartilage, consisting of cellular components in extracellular matrix composed of fibrous (mainly collageneous) elements and proteoglycan aggregate . The unique structure of the condylar cartilage comprises distinct layers , capable of adaptive remolding in response to masticatory function and external loading . The condylar cartilage is mainly a load-bearing structure for induced biomechanical stress and its thickness has been suspected to undergo functional adaptation . The TMJ performs complex hinge and sliding movement . During mastication, compressive, shearing, and other complex forces are exerted on the mandibular condyle ."}
|
{"text": "Condylar growth is affected by heredity , hormones , the environment , systemic diseases and stress and is significant in the development of the orofacial complex . Customary mastication consists a physiological stress to the TMJ, of great importance for its development in adolescence and the remodeling in adulthood . The lateral condylar displacement in the glenoid fossa as observed in the therapeutic approach of skeletal discrepancies may culminate in abnormal loading of adjacent structures, affecting the physiologic dynamics of condylar cartilage and triggering the release of growth factors and inflammatory mediators , to unknown extent and of unspecified clinical significance, a long-standing controversy."}
|
{"text": "Articular dysfunction may have adverse consequences on the potential for remodeling, resulting in histological alterations and changes in condylar volume. As a result, mandibular retrusion may lead to adverse outcomes in cartilage formation, as has been reported in rats, suggesting dysfunction and disarrangement . However, others claim that TMJ disorder should not be an issue . Clinical investigations of the effect of orthodontic mandibular displacement in humans during treatment of malocclusion have suggested that the results of treatment appear to be achieved mainly by remodeling of the TMJ ."}
|
{"text": "The present study aims to review the impact of distal mandibular dislocation on the bony and cartilaginous component of the condyle. Currently, the rat is preferred as experimental model, although earlier studies have studied monkeys as well . Additionally, the rabbit , the dog and artiodactyl mammals have been proposed as suitable models for studying TMJ dysfunction . The present review comprises studies on rodents (including rabbits) despite existing anatomical and functional differences with humans . The present investigation presents potential structural condylar changes due to mandibular distal displacement and aspires to gain further insight on the effect of increased mechanical stimulation on cellular response and growth within the condylar structures."}
|
{"text": "A specific protocol was developed and piloted according to the guidelines in the PRISMA-P statement . The Cochrane Handbook for Systematic Reviews of Interventions and the PRISMA statement were followed."}
|
{"text": "Eligibility criteria were formulated according to the PICOS (Participants, Intervention, Comparison, Outcomes and Study design) process (Supplementary Table S1). Relevant research involved healthy animals sustaining backward mandibular displacement. Review and meta-analytic articles were not regarded eligible."}
|
{"text": "Three databases (PubMed, Scopus, Web of Science) were used to identify all relevant studies independently of language, date or status of publication. They were searched since inception up to October 2020. Two authors (I.L. and M.A.M.) produced comprehensive search procedures, appropriately modified to tackle nuances in vocabulary and syntax (Supplementary Table S2)."}
|
{"caption": "A woman rides a bicycle on a road next to the median.", "url": "http://images.cocodataset.org/train2017/000000321107.jpg", "key": "000000053", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 269, "original_height": 480, "exif": "{}", "md5": "2173797723e7bf65ff2b9aef36625300"}
|
{"caption": "A toilet and a sink in small bathroom.", "url": "http://images.cocodataset.org/train2017/000000542145.jpg", "key": "000000032", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 375, "original_height": 500, "exif": "{}", "md5": "a95149dfa57a987bc60b4e491af3a4ca"}
|
{"caption": "A narrow kitchen filled with appliances and cooking utensils.", "url": "http://images.cocodataset.org/train2017/000000403013.jpg", "key": "000000014", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 301, "original_height": 450, "exif": "{}", "md5": "eb2dc2599c03b1812e248814aaabfc49"}
|
{"caption": "A kitchen filled with black appliances and lots of counter top space.", "url": "http://images.cocodataset.org/train2017/000000193271.jpg", "key": "000000011", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 480, "original_height": 320, "exif": "{}", "md5": "ce16adf7a27a00b8ba5da4724fac5daf"}
|
{"caption": "A large boat filled with mean on wheels.", "url": "http://images.cocodataset.org/train2017/000000204805.jpg", "key": "000000023", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 500, "original_height": 346, "exif": "{}", "md5": "2ae07161fbd9a7704552930ca38059ad"}
|
{"caption": "This shot is of a crowded highway full of traffic", "url": "http://images.cocodataset.org/train2017/000000061181.jpg", "key": "000000060", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 500, "original_height": 321, "exif": "{}", "md5": "5e56d8e37603ed5e8e8db8db383a2860"}
|
{"caption": "A child holding a flowered umbrella and petting a yak.", "url": "http://images.cocodataset.org/train2017/000000184613.jpg", "key": "000000002", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 500, "original_height": 336, "exif": "{}", "md5": "fd22d0e1b835109bbc1359298ce3b543"}
|
{"caption": "Two men wearing aprons working in a commercial-style kitchen.", "url": "http://images.cocodataset.org/train2017/000000005802.jpg", "key": "000000008", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 640, "original_height": 479, "exif": "{}", "md5": "dc0de0926401a4fe66c026db9e6a8641"}
|
{"caption": "There are two sinks next to two mirrors.", "url": "http://images.cocodataset.org/train2017/000000340559.jpg", "key": "000000050", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 428, "original_height": 640, "exif": "{}", "md5": "208bd27936ef5116e0f0ec3b395d3e2c"}
|
{"caption": "Two chefs in a restaurant kitchen preparing food. ", "url": "http://images.cocodataset.org/train2017/000000222564.jpg", "key": "000000009", "status": "success", "error_message": null, "width": 256, "height": 256, "original_width": 640, "original_height": 480, "exif": "{}", "md5": "5b887ef292ab938635ee44fe1aa82707"}
|
{"texts": ["Finance Available*\n\n*subject to normal lending\n\ncriteria\n\nTestimonials\n\nBananalama transformed our crudely excavated back section into a cantilevered boardwalk and deck, mounted by a garden shed and drying line. ", "Their handsome timber fence and gates now enclose the whole area, creating a liveable outdoor space out of a previously worrying wasteland and making light work of my problem. ", "These guys really know what they are doing. ", "They designed the project, gave a reasonable quote, worked within time and budget and delivered a quality finished product. ", "Not only are they efficient, they are pleasant with it. ", "I'd recommend them to anyone contemplating a garden transformation project.", "\n\nAnn David\n\nWaikanae resident\n\n\"Our driveway and entrance to the house was an ugly mishmash of different concrete put down at different times over the years. ", "The Bananalama team moved in and created an elegant entrance to the house and to a patio where we entertain a lot. ", "The exposed aggregate looks great and we now use a smaller sunny deck far more than we used to because the paths around it look so good. ", "I loved how the men all worked so well as team, especially for the concrete pour. ", "They all seemed to enjoy their work and did a very professional job.\"", "\n\nJudy and Graham Williamson - Waikanae\n\n\"Maria and I had a vision to create an Outside room, where could spend more time as a family. ", "Callum, Nick and the team took our ideas, added some of their own thoughts and then went to work.", "\n\nI was impressed with their professionalism - they completed the job on time and budget, and also took great care to ensure minimal disruption to our family. ", "We have no hesitation in recommending them and would use them again.\"", "\n\nSteve Ferguson & Maria Henry - Paraparaumu\n\n\"Bananalama have recently done extensive landscaping work for us. ", "This work exceeded our expectations and the guys and office staff were fantastic to deal with. ", "We would highly recommend them and will certainly be asking them to do more work for us. \"", "\n\nPeter and Mary George - Paraparaumu\n\nWe have been delighted by the transformation of our garden. ", "We would definitely recommend Banalama to anyone considering a landscaping or gardening project. ", "It was a huge project to tackle and Callum and his team have managed to create a wonderful garden that we could not have even imagined.", "\n\nWe were particularly impressed by:\n\nThe hardworking and professional attitude of Callum, Nick and the others in the team. ", "They all took great pride in their work\n\nThe design ideas and attention to detail.", "\n\nThe ability to work around engineering issues to create a wonderful garden.", "\n\nThe friendly and polite manner of everyone in the team .", "\n\nThe quality of the work done\n\nWe have had many lovely comments from people passing on the beach who have been watching the progress as they walked past."], "meta": {"pile_set_name": "Pile-CC"}, "scores": [0.0006389807094819844, 0.0025350558571517467, 0.0006717325304634869, 0.00053613685304299, 0.0006226870464161038, 0.0005321638309396803, 0.0010262717260047793, 0.000660895137116313, 0.0005207537324167788, 0.0005209308001212776, 0.0005869516753591597, 0.0006679723737761378, 0.000625656102783978, 0.0007191106560640037, 0.0005450482713058591, 0.0006247730343602598, 0.0005493962089531124, 0.0005155140534043312, 0.0005770380957983434, 0.0005374950706027448, 0.000576958351302892, 0.0005106778116896749, 0.0005439327214844525, 0.00056424894137308, 0.0005700078327208757, 0.000508527213241905], "avg_score": 0.000672650639899075, "num_sents": 26}
|
{"texts": ["Modeling nitrogen flux by larval insect herbivores from a temperate hardwood forest.", "\nHerbivorous insects flux considerable amounts of nitrogen from the forest canopy to the soil in the form of frass. ", "The amount of nitrogen fluxed varies depending on the characteristics of the herbivores, their food resources, and their physical environment. ", "We used concepts from metabolic ecology and ecological stoichiometry to develop a general model of individual nitrogen flux via frass fall for moth and sawfly larvae from a temperate hardwood forest in northern Wisconsin, USA. ", "We found that individual nitrogen flux (Q(N), mg N/day) was related to larval body mass (M(B), mg dry), short-term variation in environmental temperature (T, K), and larval nitrogen concentration (N(B), proportion dry mass) as Q(N) = e(25.75) M(B)(0.77) e(-0.83/kT) N(B)(-1.56), where k is Boltzmann's constant (8.62 x 10(-5) eV/K). ", "We also found that larval nitrogen flux did not vary with the nitrogen concentration of food, and suggest that this was due to compensatory feeding by larvae living on low-quality leaves. ", "With further work, models of individual N flux could be used to scale individual fluxes to population and community levels, and thus link the characteristics of insect herbivore communities with the flow of nitrogen through forested ecosystems."], "meta": {"pile_set_name": "PubMed Abstracts"}, "scores": [0.0006015425897203386, 0.0033848960883915424, 0.0005535698146559298, 0.0005961657152511179, 0.0006740870303474367, 0.0006635455647483468, 0.0005461580003611743], "avg_score": 0.0010028521147822694, "num_sents": 7}
|
{"texts": ["The Michigan paper said no one noticed the mummified body for several reasons: she lived alone; her neighbor mowed the lawn; her bills were paid automatically through her bank account; and she had long ago asked her mail carrier not to deliver anything to her home, saying she traveled frequently for work and sent most of her messages online."], "meta": {"pile_set_name": "OpenWebText2"}, "scores": [0.0034158097114413977], "avg_score": 0.0034158097114413977, "num_sents": 1}
|
{"tweet_id": 570306133677760513, "airline_sentiment": "neutral", "airline_sentiment_confidence": 1.0, "negativereason": null, "negativereason_confidence": null, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "cairdin", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica What @dhepburn said.", "tweet_coord": null, "tweet_created": "2015-02-24 11:35:52 -0800", "tweet_location": null, "user_timezone": "Eastern Time (US & Canada)"}
|
{"tweet_id": 570301130888122368, "airline_sentiment": "positive", "airline_sentiment_confidence": 0.3486, "negativereason": null, "negativereason_confidence": 0.0, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "jnardino", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica plus you've added commercials to the experience... tacky.", "tweet_coord": null, "tweet_created": "2015-02-24 11:15:59 -0800", "tweet_location": null, "user_timezone": "Pacific Time (US & Canada)"}
|
{"tweet_id": 570301083672813571, "airline_sentiment": "neutral", "airline_sentiment_confidence": 0.6837, "negativereason": null, "negativereason_confidence": null, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "yvonnalynn", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica I didn't today... Must mean I need to take another trip!", "tweet_coord": null, "tweet_created": "2015-02-24 11:15:48 -0800", "tweet_location": "Lets Play", "user_timezone": "Central Time (US & Canada)"}
|
{"tweet_id": 570301031407624196, "airline_sentiment": "negative", "airline_sentiment_confidence": 1.0, "negativereason": "Bad Flight", "negativereason_confidence": 0.7033, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "jnardino", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica it's really aggressive to blast obnoxious \"entertainment\" in your guests' faces & they have little recourse", "tweet_coord": null, "tweet_created": "2015-02-24 11:15:36 -0800", "tweet_location": null, "user_timezone": "Pacific Time (US & Canada)"}
|
{"tweet_id": 570300817074462722, "airline_sentiment": "negative", "airline_sentiment_confidence": 1.0, "negativereason": "Can't Tell", "negativereason_confidence": 1.0, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "jnardino", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica and it's a really big bad thing about it", "tweet_coord": null, "tweet_created": "2015-02-24 11:14:45 -0800", "tweet_location": null, "user_timezone": "Pacific Time (US & Canada)"}
|
{"tweet_id": 570300767074181121, "airline_sentiment": "negative", "airline_sentiment_confidence": 1.0, "negativereason": "Can't Tell", "negativereason_confidence": 0.6842, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "jnardino", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica seriously would pay $30 a flight for seats that didn't have this playing.\nit's really the only bad thing about flying VA", "tweet_coord": null, "tweet_created": "2015-02-24 11:14:33 -0800", "tweet_location": null, "user_timezone": "Pacific Time (US & Canada)"}
|
{"tweet_id": 570300248553349120, "airline_sentiment": "neutral", "airline_sentiment_confidence": 0.634, "negativereason": null, "negativereason_confidence": null, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "pilot", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica Really missed a prime opportunity for Men Without Hats parody, there. https://t.co/mWpG7grEZP", "tweet_coord": null, "tweet_created": "2015-02-24 11:12:29 -0800", "tweet_location": "Los Angeles", "user_timezone": "Pacific Time (US & Canada)"}
|
{"tweet_id": 570295459631263746, "airline_sentiment": "positive", "airline_sentiment_confidence": 1.0, "negativereason": null, "negativereason_confidence": null, "airline": "Virgin America", "airline_sentiment_gold": null, "name": "YupitsTate", "negativereason_gold": null, "retweet_count": 0, "text": "@VirginAmerica it was amazing, and arrived an hour early. You're too good to me.", "tweet_coord": null, "tweet_created": "2015-02-24 10:53:27 -0800", "tweet_location": "Los Angeles", "user_timezone": "Eastern Time (US & Canada)"}
|
{"docid": "2", "text": "God at Sinai granted Aaron the priesthood for himself and his male descendants, and he became the first High Priest of the Israelites. Aaron died before the Israelites crossed the North Jordan river and he was buried on Mount Hor (Numbers 33:39; Deuteronomy 10:6 says he died and was buried at Moserah). Aaron is also mentioned in the New Testament of the Bible. According to the Book of Exodus, Aaron first functioned as Moses' assistant. Because Moses complained that he could not speak well, God appointed Aaron as Moses' \"prophet\" (Exodus 4:10-17; 7:1). At the command of Moses, he let", "title": "Aaron"}
|
{"docid": "3", "text": "his rod turn into a snake. Then he stretched out his rod in order to bring on the first three plagues. After that, Moses tended to act and speak for himself. During the journey in the wilderness, Aaron was not always prominent or active. At the battle with Amalek, he was chosen with Hur to support the hand of Moses that held the \"rod of God\". When the revelation was given to Moses at biblical Mount Sinai, he headed the elders of Israel who accompanied Moses on the way to the summit. While Joshua went with Moses to the top,", "title": "Aaron"}
|
{"docid": "4", "text": "however, Aaron and Hur remained below to look after the people. From here on in Exodus, Leviticus and Numbers, Joshua appears in the role of Moses' assistant while Aaron functions instead as the first high priest. The books of Exodus, Leviticus and Numbers maintain that Aaron received from God a monopoly over the priesthood for himself and his male descendants (Exodus 28:1). The family of Aaron had the exclusive right and responsibility to make offerings on the altar to Yahweh. The rest of his tribe, the Levites, were given subordinate responsibilities within the sanctuary (Numbers 3). Moses anointed and consecrated", "title": "Aaron"}
|
{"docid": "5", "text": "Aaron and his sons to the priesthood, and arrayed them in the robes of office (Leviticus 8; cf. Exodus 28-29). He also related to them God's detailed instructions for performing their duties while the rest of the Israelites listened (Leviticus 1-7, 11-27). Aaron and his successors as high priest were given control over the Urim and Thummim by which the will of God could be determined (Exodus 28:30). God commissioned the Aaronide priests to distinguish the holy from the common and the clean from the unclean, and to teach the divine laws (the Torah) to the Israelites (Leviticus 10:10-11). The", "title": "Aaron"}
|
{"docid": "6", "text": "priests were also commissioned to bless the people (Numbers 6:22-27). When Aaron completed the altar offerings for the first time and, with Moses, \"blessed the people: and the glory of the appeared unto all the people: And there came a fire out from before the , and consumed upon the altar the burnt offering and the fat [which] when all the people saw, they shouted, and fell on their faces\" (Leviticus 9:23-24). In this way, the institution of the Aaronide priesthood was established. In later books of the Hebrew Bible, Aaron and his kin are not mentioned very often except", "title": "Aaron"}
|
{"docid": "7", "text": "in literature dating to the Babylonian captivity and later. The books of Judges, Samuel and Kings mention priests and Levites, but do not mention the Aaronides in particular. The Book of Ezekiel, which devotes much attention to priestly matters, calls the priestly upper class the Zadokites after one of King David's priests. It does reflect a two-tier priesthood with the Levites in subordinate position. A two-tier hierarchy of Aaronides and Levites appears in Ezra, Nehemiah and Chronicles. As a result, many historians think that Aaronide families did not control the priesthood in pre-exilic Israel. What is clear is that high", "title": "Aaron"}
|
{"docid": "8", "text": "priests claiming Aaronide descent dominated the Second Temple period. Most scholars think the Torah reached its final form early in this period, which may account for Aaron's prominence in Exodus, Leviticus and Numbers. Aaron plays a leading role in several stories of conflicts during Israel's wilderness wanderings. During the prolonged absence of Moses on Mount Sinai, the people provoked Aaron to make a golden calf. (Exodus 32:1-6). This incident nearly caused God to destroy the Israelites (Exodus 32:10). Moses successfully intervened, but then led the loyal Levites in executing many of the culprits; a plague afflicted those who were left", "title": "Aaron"}
|
{"docid": "9", "text": "(Exodus 32:25-35). Aaron, however, escaped punishment for his role in the affair, because of the intercession of Moses according to Deuteronomy 9:20. Later retellings of this story almost always excuse Aaron for his role. For example, in rabbinic sources and in the Quran, Aaron was not the idol-maker and upon Moses' return begged his pardon because he felt mortally threatened by the Israelites (Quran 7:142-152). On the day of Aaron's consecration, his oldest sons, Nadab and Abihu, were burned up by divine fire because they offered \"strange\" incense (Leviticus 10:1-3). Most interpreters think this story reflects a conflict between priestly", "title": "Aaron"}
|
{"docid": "10", "text": "families some time in Israel's past. Others argue that the story simply shows what can happen if the priests do not follow God's instructions given through Moses. The Torah generally depicts the siblings, Moses, Aaron, and Miriam, as the leaders of Israel after the Exodus, a view also reflected in the biblical Book of Micah. Numbers 12, however, reports that on one occasion, Aaron and Miriam complained about Moses' exclusive claim to be the 's prophet. Their presumption was rebuffed by God who affirmed Moses' uniqueness as the one with whom the spoke face to face. Miriam was punished with", "title": "Aaron"}
|
{"text": "Ip 246 Jud. SALAJ, Loc. IP", "start": 0, "end": 25}
|
{"id": 6, "name": "UniRef90_A0A401TRQ8", "text": "PPSFIHKPDPQEVLPGSNVKFTSVVTGTAPLKVSWFKGTTELVAGRQCYISLSDSTAILELLNVESSQSGDYICQVSNEAGKVSCTTKLFVKEPAVFQKKLKDCSVVLGKSVCLDCTYTGTPEIKVSWKKNGLVIFQSDKHIL"}
|
{"id": 7, "name": "UniRef90_A0A672ZWI7", "text": "MVIHQRHTSDESFSSSPVEIRITAATPIPELAEERSAEKPPAVTETPSDVPMTDDAQMKHKFTFSFDASGGALNVVRELENITCSEGNTAVLECEISGDPTPEATWYYDEISLKFATEKYRFEVDDKVYRLYINSFTYSDAGVYKCVARNKMGEVASIADVSFQVAEPGQFSEFGDTNEGNQRVRKPHD"}
|
{"labels": 3, "text": "Good shoe for office work. They will scuff very easy so be aware."}
|
{"labels": 1, "text": "I have had the Patricia II wedge in black for about 1 year & wore them regularly in season. When I saw the Patricia at a good price in navy (from 6pm), I purchased them because I thought they would fit just like my Patricia IIs. I was wrong, and paid the price with return shipping that 6pm doesn't pay.<br /><br />The crocs website says that crocs aren't suppose to fit like other sandals - they are suppose to be looser & thus more comfortable - I normally wear an 8-1/2, so have now tried both an 8 & a 9 in the Patricia shoe (I have an 8 in the Patricia II). The Patricia 9 swims on my feet & they would be a hazard to walk around in. The size 8 fits my left foot (which is my wider foot) but is too narrow on my right foot. When I placed the shoes sole to sole, I did notice a slight difference in the width, which, apparently, my foot notices too. I can only conclude a manufacturing defect. But, it is this shoe specifically or the form for this shoe? (others have written the shoe is narrow).<br /><br />Consequently, if you have a wider foot, order the Patricia II instead of this one & if you are a 1/2 size, order down, not up."}
|
{"labels": 1, "text": "Width not right and size too small if width had been just little wider and ordered size larger would have been good. Loved the shoe look"}
|
{"labels": 0, "text": "I received these shoes and they weren't the same as the picture described them, they were a different color. When i tried to return them, the shipping wasn't paid for. So i had to pay $20 for shipping. A waste of time and money. I dont recommend anyone to buy from TheSmartBuy."}
|
{"labels": 2, "text": "They began to split alone the mesh material after a month but loved the shoe and the feel of it"}
|
{"labels": 4, "text": "Excellent shoes , very confortable and litgthweight !"}
|
{"labels": 0, "text": "Usually love Ethnies product. In this case the raised arch area of one shoe is too far back and raised to the point of discomfort.<br />The other shoe fits fine.?? Had to wear em before I figured it out so im stuck with em.<br />Also, they do run a bit narrow(or at least one shoe did) ;)"}
|
{"labels": 1, "text": "Could not get my foot into the shoe. Was disappointed and returned them."}
|
{"labels": 3, "text": "Everything about the boot is great."}
|
{"labels": 2, "text": "Nice looking shoe, okay for short-term wear. Much narrower than other size 11's that I have - tight fit!"}
|
{"text": "i didnt feel humiliated", "label": 0, "tweet_length": 4}
|
{"text": "i can go from feeling so hopeless to so damned hopeful just from being around someone who cares and is awake", "label": 0, "tweet_length": 21}
|
{"text": "im grabbing a minute to post i feel greedy wrong", "label": 3, "tweet_length": 10}
|
Subsets and Splits
No community queries yet
The top public SQL queries from the community will appear here once available.